DPCstruct | MC24655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 69 ± 4 aa |
| Standard deviation of domain lengths | 3.74 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12512 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151QDG6 | 5-78 | APQQISIIELERAINYWRSKYPSSRDTMTLCPQASCLAELYARMIIFQIHEISIAEFSAKARKALGEAEQAFAD |
| A0A2M6UZS1 | 2-66 | ASIHITDIEAAINYWRDRSPSPDGITLAPELRALAEVYALMVFHHQDEAAERGFPSKALDAWLTW |
| I2DU47 | 81-150 | None |
| A0A4R5L1V3 | 17-89 | None |
| A0A4R0XN11 | 21-85 | None |
| A0A6P2W6Q3 | 1-70 | None |
| A0A328ZPN3 | 1-66 | None |
| A0A4Q3NS11 | 2-73 | None |
| A0A378YF17 | 101-172 | None |
| A0A7W9WW61 | 2-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.