DPCstruct | MC24654
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Standard deviation of domain lengths | 8.73 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S6BAX4 | 1-72 | YDRLFPNQDTKPLGGFGNLIALPLQSGARKAGNSVFVDSDMRPYGDQWAYLSSLPRMSLAAVTKHVEAAELS |
| A0A450U048 | 1-91 | MTTFSFDSYDRLFPNQDIMPEGGFGNLIALPLQYHARGKGNSVFVDTNLSAYPDQWTFLSQLGRLTAKRLDELVEQISPGLSKAPDD… |
| A0A7X2XS30 | 2-81 | None |
| A0A2N8CCZ1 | 19-94 | None |
| A0A4R7ZJ52 | 12-83 | None |
| A0A1M5WXW3 | 8-88 | None |
| A0A7W0JYS0 | 103-194 | None |
| A0A4R2W772 | 17-112 | None |
| A0A838V2U8 | 12-85 | None |
| A0A351U154 | 12-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.