DPCstruct | MC2465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 47 ± 4 aa |
| Standard deviation of domain lengths | 4.20 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 65.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A560WED7 | 7-50 | VGKVTIKQKCCVSKKRCSSCPIRLLAEGRMPKGYTVHKRKLVTV |
| A0A542XGH4 | 1-48 | MAKKSKQRKPKKECCVSKSRCQRCPIRMLREGTLPEGYTVKKRKLVKA |
| A0A7W1V5I3 | 5-63 | None |
| A0A7V9PTA1 | 1-45 | None |
| A0A562CW63 | 80-126 | None |
| A0A200HFB0 | 2-42 | None |
| A0A3N0CGH1 | 6-47 | None |
| A0A7W0L7X7 | 2-49 | None |
| A0A542YQI3 | 26-71 | None |
| A0A6L6AQ54 | 1-46 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.