DPCstruct | MC24641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 131 ± 17 aa |
| Standard deviation of domain lengths | 16.51 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 43.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14711 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379ADL9 | 40-178 | AHTGVLPDVESLRIPVEYLANLLTAGDTAPVLLALKRMLAMRHYKRAESVDGEHDIRALEQVGLTEAQAQEMYRYLAIANYEDRFVV… |
| A0A4D4KLN5 | 79-198 | FDWQRRAAVTRLRIPLEYLAELFTAGDTDVVAGVLMKLTALRSYMRARALGEPGHEAVLKAVGLTPRNGEELHRLLAVAKYADRYVV… |
| A0A0C2MKV8 | 343-471 | None |
| A0A7R9A1L1 | 8-136 | None |
| A0A6G3V9C7 | 5-123 | None |
| A0A3S4IK93 | 2-100 | None |
| A0A6N9YES9 | 1-127 | None |
| A0A7Y5RTR5 | 134-276 | None |
| A0A1J5Q5R7 | 268-408 | None |
| A0A376VI46 | 59-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.