DPCstruct | MC24637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 125 ± 18 aa |
| Standard deviation of domain lengths | 17.77 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P5WL43 | 11-106 | GVSSLVNPRPPSKEFVSPFLETGNKDPKLNSISNEIKPRYNPCHPSALVMPRPTVDIQCKESQRGMVILDVVVDPLLSKNLRSHQGD… |
| A0A402G3R6 | 1-149 | AGYKAKDLENLDEGQALKIGGKEIEVLGVIEEEDFQSGKCFHSGGEVLVDTLNFSHSTVKPFCNPLKNVSKTSNQGNMLKGSQNYKP… |
| A0A667HYJ0 | 387-510 | None |
| F4SA66 | 23-156 | None |
| A0A0B7FU91 | 422-562 | None |
| X8IXV6 | 400-535 | None |
| A0A1X7SLB5 | 1-89 | None |
| A0A7R9T201 | 1-127 | None |
| A0A4Q2DUG4 | 4-146 | None |
| A0A226NQJ3 | 84-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.