DPCstruct | MC24636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 580 ± 69 aa |
| Standard deviation of domain lengths | 68.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 67.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF01594- PF19438 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I4KI47 | 2-594 | SLVEQLMSSSDRWIALQFAFYNALLLALTGICLVGLYAVYKVMYMFLTPLLWATLIGTILFPVKKKFNCAINGWLSRVDNGETPLLV… |
| A0A0P5R194 | 5-614 | DLRSPFVERVISLLPRGHEEAMKQAFYNVAAIFLFILMAGATMAVYFILEPFVKPLLWAILVGSVLHPVKQKSVVVTSNWLSELREA… |
| A0A1B0BNT1 | 184-794 | None |
| A0A7R9JEY7 | 13-501 | None |
| A0A0V0XM46 | 8-615 | None |
| A0A2A2KNI0 | 548-970 | None |
| A0A1B6DI67 | 1-646 | None |
| Q4RI43 | 38-600 | None |
| A0A1B0D6D9 | 2-528 | None |
| A0A6J2XSS5 | 1-572 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.