DPCstruct | MC24632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 66 ± 8 aa |
| Standard deviation of domain lengths | 7.77 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 55.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0441 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060NGI1 | 5-69 | KLPISLTDLLRQRTVEGERIEYKAGWNPDPIIRTVCAFANDFENLGGGYVVIGQDCDANGQPVFP |
| A0A7Y6UWG4 | 1-73 | MQGKLPINLADLLRQRTVEGERIEYKAGWNPDAVVRTLCAFANDFENIGGGYIVIGQALQCRGVAAIPTHRRG |
| A0A132GT97 | 1-54 | None |
| A0A7X4JIY3 | 1-69 | None |
| A0A7X0R0P3 | 1-78 | None |
| A0A1R3T2Y9 | 3-65 | None |
| A0A1I4CCU8 | 1-72 | None |
| A0A7Z8NL96 | 1-63 | None |
| A0A6J4YPA7 | 1-54 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.