DPCstruct | MC24630
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 98 ± 6 aa |
| Standard deviation of domain lengths | 6.42 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7L4NYZ0 | 83-180 | QPQIYLELHCYHPDKKLKLTGKNRKELFGVPSLVELENGVLIGSTSPLIRSVFFDLYDFPFILEIPCQPSPESLEVAKKMMEIASKS… |
| A0A7J3W6L3 | 4-96 | PDMYIEVHCYKLSSYDSLTSPSRIHVKGVPPLLELERGVLIGSISPLLKAKLNLNLPVLIETPCGRRENFKVALRILRVFLTANSIP… |
| A0A849QPM4 | 1-97 | None |
| A0A662R075 | 34-134 | None |
| A0A843GE58 | 10-124 | None |
| A0A6A2FR88 | 1-91 | None |
| A0A1V4YPM5 | 33-131 | None |
| A0A7J3TXD2 | 87-179 | None |
| A0A0E3L4X5 | 123-217 | None |
| A0A645GIA7 | 14-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.