DPCstruct | MC24627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 66 ± 13 aa |
| Standard deviation of domain lengths | 13.42 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A133VNL3 | 31-94 | AMWFQDAWNLDINRLKKCVIHYSTPEGIVPFCSYNGINTGQEIRKKHSMSVEEWEEKTGKGLKD |
| A0A7J3R013 | 4-71 | RTAILLSAMHFMDPYNFDLERVQRCVIHYAVPDGRIIPFCTMNSIHRSGIEKDLGLPIKEWVAKHNVE |
| A0A662T967 | 109-174 | None |
| A0A497T594 | 185-256 | None |
| A0A849QYT9 | 23-79 | None |
| A0A7C0XNR2 | 58-111 | None |
| A0A399Z5C4 | 40-97 | None |
| A0A535VLP0 | 113-189 | None |
| A0A2J6NCC8 | 1-73 | None |
| A0A7J4KS19 | 131-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.