DPCstruct | MC2462
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 67 ± 4 aa |
| Standard deviation of domain lengths | 4.29 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 69.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 74.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2MJ29 | 481-551 | EVYRVSDMELVRVLPSAEDEVNVACFHPFAGGGLVYGTKEGKLRVLRFDGAHDVNYARPNYFPEDNLTEVE |
| A0A438IJC0 | 9-72 | MELVRVLPSAEDEVNVACFHPSVGGGLVYGTKEGKLRILQYDSSHGMNYTSSCFLDENMLEEKL |
| A0A061DQA7 | 469-539 | None |
| A0A7C9ALL0 | 127-198 | None |
| A0A6V7PJ59 | 1-60 | None |
| A0A2J6L016 | 8-71 | None |
| A0A438KDD3 | 610-681 | None |
| A0A6A6KBT6 | 190-252 | None |
| A0A2P2JN34 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.