DPCstruct | MC24617
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 142 ± 22 aa |
| Standard deviation of domain lengths | 21.98 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 16.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11428 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7ZRJ1 | 13-118 | GSTVNLEEFDWVDPTQKETAERLLQGLEQDQQPPEIQMLALQKWHLYATAVKPLIRKSEVFAAAMEYVLQQFAPTATTQKQLAEKYN… |
| A0A645DRJ4 | 6-165 | IRKENIIELEEVIRKYILRPDIDKNIKIEAAFLLNKIGAKEPYYVLMDGEIKEITIEPDGLLEDEWKKEWEEVKNKTLKMMKSCYKT… |
| F5LAJ4 | 53-217 | None |
| A0A4V0YFK5 | 30-154 | None |
| A0A2T6EQJ5 | 2-158 | None |
| A0A0N1KH42 | 31-190 | None |
| A0A1H0Y6R1 | 167-319 | None |
| A0A6C1WCH6 | 2-92 | None |
| A0A645FJ67 | 57-204 | None |
| A0A2A6E1Y5 | 60-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.