DPCstruct | MC24613
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 71 ± 3 aa |
| Standard deviation of domain lengths | 3.41 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 47.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6ZYP4 | 56-126 | QYRKNQPFNCNHLRPCPLLDNPACLAAMVHASGAASTELTAPEDVDVLTGRCVPAARSWASRADKIQRQGA |
| A0A645DGY3 | 1-73 | MAYREKQPFNENHLRPCPMLENPECLRKMIEETGAKSTDIISPECVNHLCDKCIPYANSWEETANRLWDESKK |
| A0A7C7D1L3 | 159-231 | None |
| A0A1G9RPW8 | 388-460 | None |
| A0A1H3ERR6 | 16-86 | None |
| A0A645JRA3 | 1-73 | None |
| R5LC73 | 1-70 | None |
| R6C2R9 | 85-145 | None |
| A0A7X2PCN0 | 84-154 | None |
| A0A7C7A3P8 | 10-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.