DPCstruct | MC24611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 156 ± 32 aa |
| Standard deviation of domain lengths | 31.54 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 90.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A073KPZ5 | 10-142 | LEEFRSHDGLHYKNLWREVGDGWFCLSCKRSKYEIMRWAKRFPNSPNAFWGWIAPLHKHHDHSAPYMSNQGRFPMTTICDQCNSSDG… |
| A0A5E4Z8G5 | 20-165 | ERRIPTHADFVAYDGHHCHALYKSLPPDWRCPGCCRSTFEVLRWTMRFPHLPTKFLGWAGGYHRHHDHAGDRRGGRLLWNSPYARFP… |
| A0A125NUS2 | 16-253 | None |
| A0A2N6QAL6 | 40-211 | None |
| A0A2N6QAM2 | 2-111 | None |
| A0A4R0XA42 | 49-185 | None |
| A0A7W6CM68 | 15-239 | None |
| A0A2A4UDD3 | 18-162 | None |
| N9RYY8 | 40-214 | None |
| A0A317I8U2 | 29-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.