DPCstruct | MC24610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Standard deviation of domain lengths | 6.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4UQ12 | 1-77 | MIRVTIEVVPGGDESRRRHVGTIEIANDGTGDEERGNYSIRLSKFGNPAQTWIRGVVKGFDRIRRGPYDLLFQCLDA |
| A0A2E7P7S0 | 1-80 | MIHVRIEMWPLGDQSKARHMGTIEIANDGTGTREEGNYKVRLSRMDSPTRAWKSLAIKSFNRVTRGPHDLLLLALLSGVG |
| A0A1V5X3A1 | 1-70 | None |
| A0A7W8V9Y8 | 1-77 | None |
| A0A170PVA4 | 1-81 | None |
| A0A7X9DI85 | 1-77 | None |
| A0A1Y5R8R3 | 1-75 | None |
| A0A0F9KE73 | 1-84 | None |
| A0A0F9RI45 | 20-97 | None |
| A0A5C7QFY7 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.