DPCstruct | MC2461
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 183 ± 42 aa |
| Standard deviation of domain lengths | 41.77 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 86.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.10 |
| Pfam Score | 84.40 |
| Assigned Pfam label(s) | CL0015- PF00643- CL0105- PF04253- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438IHY8 | 293-459 | DPMFHRHAAGVLPFDYLSYAYELQKSAKELEGEISNKGINLIPLFKSIEKFKRAATKINHQRKEIEENKGWASIWKKEHLKVRELND… |
| A0A834A8T9 | 23-211 | AFDTFDYVDKFVDPGFSSHQAVAQTAGNVLLRLSDSLFLPLNVSDYSETLRSFLQAAQQDLGALLEQHNISLGPLVAAVEKFEGAAV… |
| A0A135V988 | 874-1063 | None |
| A0A813TV93 | 540-723 | None |
| A0A0S7DML0 | 4-187 | None |
| G0PNK9 | 11-198 | None |
| H0EGM8 | 550-814 | None |
| A0A7J0GEZ5 | 414-585 | None |
| A0A2B4SUH7 | 93-226 | None |
| A0A6N9F482 | 6-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.