DPCstruct | MC24609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 79 ± 10 aa |
| Standard deviation of domain lengths | 9.75 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 93.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A515KSM7 | 19-102 | MGAVQREHKGFEPDEFVAYAFTDPILRGSKITAPGGAIRSNGKWYRLSYTCKTNADGLDVVAFAYQLGGEVPRREWDAHYLVPK |
| A0A5S4YVR9 | 13-83 | PDELVAYAYGDPRSSGAVVDASGAAVRSGNAWYHLAYSCQTSADGLNIERFKYSLGGAIPKGEWAKHYLVA |
| A0A839P6H3 | 1-65 | None |
| A0A2S5U035 | 131-212 | None |
| A0A1E5XSV2 | 239-332 | None |
| A0A537LDS9 | 69-146 | None |
| A0A1B1C9Y5 | 1-67 | None |
| A0A5Q0CAL1 | 287-379 | None |
| A0A5D0VXY0 | 4-63 | None |
| A0A346R6G0 | 183-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.