DPCstruct | MC2460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 252 ± 44 aa |
| Standard deviation of domain lengths | 43.54 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7WHX9 | 61-353 | TWRVTVSDAKYHWYDLFAGFPERPDIRDPVGRQLRRMQFDLEATMEKRLIYFVINRPIVRFDPTRTVSWAFFSLKLTVPILVGSEGK… |
| A0A7U1HBQ8 | 11-248 | ASLEYPIATAYDLEMLLGQEVVENLVADCTIYAITQRPAIYFDNVNIKELARGRFICQITDGKNIPIDCFFNIPVEEWDVLNVESKF… |
| A0A1F1GNT7 | 79-262 | None |
| F4KV95 | 108-386 | None |
| A0A5Q2NLX5 | 2-252 | None |
| W5IJD9 | 14-333 | None |
| A0A4P6FVA2 | 2-219 | None |
| A0A699GEG1 | 36-356 | None |
| A0A7T9NH69 | 20-199 | None |
| A0A6G3CPW8 | 4-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.