DPCstruct | MC24598
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 231 ± 20 aa |
| Standard deviation of domain lengths | 20.34 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L7XBP7 | 69-296 | WPLAATTAAVLALASATMAGRRRLSWPVAAHWRTYLLACAGPLLVVLAVVVLGVAVSHDGDPTPLLFLPVLNPLGVLIGLQLAALLA… |
| A0A7Y3PBK0 | 14-263 | AVLVGAVYFVLARQTFVRHKDDKLLLLSEMGLASVFAVIAIPIAWKWEWITIGWSVEAAVLLAIGFRLREPLARWAGRGLLVAAGLR… |
| A0A5C7G0X0 | 62-288 | None |
| A0A831RI85 | 147-387 | None |
| A0A0C2YSB0 | 8-217 | None |
| A0A656YTP1 | 5-191 | None |
| X0SAX3 | 8-252 | None |
| S3T7W5 | 4-214 | None |
| A0A2T0NZV4 | 534-788 | None |
| A0A7U6KSM2 | 491-753 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.