DPCstruct | MC24597
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 121 ± 26 aa |
| Standard deviation of domain lengths | 26.40 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2JAU5 | 140-232 | LVSLRDVIRKKNFRNKKDIEKLVDRCLDEIDMPPLFYDIDALASYFKRSPPKIFRMMRLLEKEGYRVSRTHFRDTSFKTDAPLDEVI… |
| A0A7C1IKF9 | 31-135 | GPLWTGPLQDKKAVSFMAGKAGECNLARPREVRRLLHLVGDEVDAPPLYYQAGVLCKSLGIPQPPLGKVLDSLRQNGYRAVRTHCDP… |
| A0A7J3TU33 | 27-136 | None |
| A0A067BGJ4 | 89-228 | None |
| A0A3B4G9B4 | 334-464 | None |
| A0A2A4JVD7 | 332-459 | None |
| A0A017S9L2 | 682-851 | None |
| A0A7J0EDA6 | 116-223 | None |
| A0A7J2JXU4 | 4-81 | None |
| A0A267G7C3 | 261-399 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.