DPCstruct | MC24596
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 290 ± 21 aa |
| Standard deviation of domain lengths | 20.68 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5M657 | 34-306 | GLIGAAAAISWEPGDKTYELISYRYREKWGKERDVKEESVIKMDKTINSTFDNYDYEEKRVLITPNSPCPILFGIRGDKPCDLIKAK… |
| A0A5E4IZ08 | 244-545 | YQRAVTDILEIREARELLEEEGIWYRGFKKGRGLIGALAAVGADLPDFTYELIAYRERRRWGTPRVIDQESVWKADDLTYPLTWDTV… |
| A0A662T466 | 27-334 | None |
| A4YJ31 | 143-409 | None |
| A0A7C2ZCR7 | 129-440 | None |
| A0A533VZJ3 | 2-288 | None |
| A0A2E3X0Z6 | 37-327 | None |
| A0A843EHA4 | 83-385 | None |
| A0A7M3W8C6 | 2-242 | None |
| A0A1V5AEE5 | 162-461 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.