DPCstruct | MC24594
Metacluster Properties and Pfam Annotations
| Number of structural domains | 566 |
|---|---|
| Mean domain length (aa) | 308 ± 93 aa |
| Standard deviation of domain lengths | 92.79 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 82.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 15.14 |
| Pfam Score | 99.47 |
| Assigned Pfam label(s) | CL0322- CL0213- PF00375 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A660RJ91 | 2-174 | SKILARYEYNYTIAGTIFVWVKINSEILSSQIKSLFIALLLIFTIVLAIFRRLIISLTTMIPIGFTALMNFINMTVLHINLEISTSI… |
| A0A7C1W1Z8 | 65-318 | DSNGIPKDNRDVKQLYDYLLKSEEYRKDAKTILHKNGDDYDATVIRVYTTVSSQSNSNETGKELEILYNELVEDIPSFKDCRVSLTG… |
| A0A6G3UY39 | 2-260 | None |
| A0A6G3V360 | 1-242 | None |
| A0A3M1HWH6 | 74-333 | None |
| A0A532E860 | 95-558 | None |
| A0A1Q9TF46 | 20-283 | None |
| A0A7C1MM54 | 206-508 | None |
| A0A7V3H3G3 | 6-187 | None |
| A0A812PAA9 | 66-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.