DPCstruct | MC2459
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 118 ± 11 aa |
| Standard deviation of domain lengths | 10.73 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q5RCQ9 | 1-104 | MSLFEAKHRTRQEPKKQGESDFAFYDSCAWPEIETYRQLLNKWINEFPEPERAEMIARMRDSDSSYYQAALAELMMHATLVKLGYKV… |
| A0A7U1D4T7 | 1-122 | MLFDIKFDRVCTDKDRGKKSHFEFINNSALPEYCKIRSLLNMCFNEFDEKSQNDIRSRIIKNKSEEKFYSTCFELLVAHIFRRLGCQ… |
| A0A1W2FZH2 | 20-149 | None |
| A0A7Y4XT79 | 43-149 | None |
| A0A3D9HRB7 | 1-118 | None |
| A0A1I3S1S9 | 5-144 | None |
| A0A2V7QI36 | 542-647 | None |
| A0A535N5L8 | 80-193 | None |
| A0A3D1TRZ0 | 5-118 | None |
| A0A351VHV4 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.