DPCstruct | MC24589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 147 ± 29 aa |
| Standard deviation of domain lengths | 28.72 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 22.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02341 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7D7C4 | 59-170 | SPERKAATNLQHFFNYVAVRVVLSQLESYNREAYYELKEFVSRTSLNDAEIFCKKLIRESPRLKGLAMRILEVRSAYVKSDFEWDNL… |
| A0A3M7L2M1 | 2-138 | DDDCAHDYFDRTTAAVVMRVLTAQATKRVLHQLQESDLIIAQWLNHFCAEHPPLDGNKFILSLLSMKGTTVDEAAFGVTHHINPQNI… |
| B9RID3 | 52-163 | None |
| A0A540K3Y4 | 2-110 | None |
| A0A6T7WBC7 | 37-203 | None |
| A0A811MIE1 | 471-583 | None |
| M8ARY6 | 71-217 | None |
| A0A7S1H9Y4 | 3-139 | None |
| A4RUG2 | 5-158 | None |
| A0A5A7RBE0 | 189-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.