DPCstruct | MC24588
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 146 ± 33 aa |
| Standard deviation of domain lengths | 33.32 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 72.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 52.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06047 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A139Y2U0 | 4-107 | PRLIYGGALRPGEGAAIAQYVQEGKRIPRRGEVGLTADEIQAFEDLGYVMSGSRHRRMNAIRIRKENQVYSAEEQRALAMFNYEEKA… |
| A0A3M7KXI9 | 30-158 | AADAAAAAAAAEEEDRLVGPEAPAGAGGVNADYGTHLRPGEGTAMAAFVQSGQRIPRRGEVGLTSSEIDNFESAGYVMSGNRHARMN… |
| A0A6S7GXV1 | 146-302 | None |
| A0A1B0AK99 | 318-436 | None |
| A0A482WTD9 | 78-261 | None |
| A0A4U5MID0 | 412-585 | None |
| A4S4L9 | 32-204 | None |
| A0A2I4AVK6 | 446-569 | None |
| A0A044SY36 | 307-469 | None |
| A0A815G6C1 | 871-997 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.