DPCstruct | MC24585
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 166 ± 29 aa |
| Standard deviation of domain lengths | 28.60 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D2A4K5 | 3-160 | ARDLTLHISSKLAGEWSAPNVAGMLTAPVLEYLVSKWSDLDTMVKTRLLLAPLAMKGASLEELRPQLQAMVEAGVADKDEWVRVMAL… |
| A0A7J8ANL4 | 4-145 | MRESDTGLWLHNKLGATDELWAPPSIASLLTAAVIDNIRLCFHGLSSAVKLKLLLGTLHLPRRAVDEMKGALAEIIQLAALDSDPWV… |
| F1A3Y2 | 1-172 | None |
| A0A2N1MPM4 | 7-139 | None |
| A0A7E4RIN4 | 3-177 | None |
| A0A183DVD3 | 33-153 | None |
| A0A662Y925 | 54-231 | None |
| A0A3P6SXJ6 | 22-189 | None |
| A0A0N4ZSZ7 | 8-264 | None |
| A0A1I8I114 | 5-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.