DPCstruct | MC24582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 53 ± 2 aa |
| Standard deviation of domain lengths | 2.28 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 95.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 61.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0441 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S0X4N0 | 1-52 | MEILKVKATSVPNSVAGALAGVIRERGTAEIQAIGAGALNQAVKAVAIARGF |
| A0A6J4UDH9 | 109-159 | EILKVSARSRPSAVAGAIAGVVREAGRAEVQAIGAGATNQAIKAVAIARDY |
| A0A7Z9WPA5 | 1-52 | None |
| A0A1M6MAP1 | 31-82 | None |
| A0A538IR57 | 1-54 | None |
| A0A7J9WFK8 | 1-52 | None |
| A0A133XSA1 | 39-90 | None |
| A0A3S0ICJ1 | 1-52 | None |
| A0A847NV34 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.