DPCstruct | MC24581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 349 ± 34 aa |
| Standard deviation of domain lengths | 33.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 13.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2RHQ8 | 14-358 | KIIHSTQIEAEKFFDLIDNSNIILLEETSLLILNELNLLDDFLKLLPSFSIVDSVFKKINLTTHEPVSINSQISGAILKAIQNNIEK… |
| U7NG71 | 170-480 | RTQAFKALEENQGRGCIVDALTLNIIRRLAIEIVVESVCGPIAITGSTRDVYWSRLKQMQAETVPSMSIHWQDGHLVRQELAKEELD… |
| A0A4P7HJF9 | 103-472 | None |
| A0A5E6X4S1 | 185-614 | None |
| A0A0N0XAI8 | 16-395 | None |
| A0A2Z6AN13 | 298-652 | None |
| A0A316S668 | 410-730 | None |
| A0A1G0SXM9 | 242-571 | None |
| A0A6H2CDI4 | 615-975 | None |
| A0A4Q3ZL47 | 5-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.