DPCstruct | MC2458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1743 |
|---|---|
| Mean domain length (aa) | 195 ± 42 aa |
| Standard deviation of domain lengths | 42.06 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.27 |
| Pfam Score | 71.07 |
| Assigned Pfam label(s) | CL0531- CL0063- CL0099- CL0378- CL0046 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535QV51 | 4-101 | VIIRGGENIAPREVEEVLMWHAAVREAAVVGRPDPIYGEQVVAYVAVQGAWSEEMAQELRQYAARRLSPHKVPVDFMALDALPRNQM… |
| A0A445KPD3 | 287-465 | CYQFVPNGTQCPEDVACVGEVGLFPIYMGATDRLLNADNEEVYFKGMPIYKGKVLRRHGDIIKRTAGGRFIGQGRADDTMNLGGIKT… |
| A0A521YI95 | 352-555 | None |
| A0A6G1IUU7 | 128-311 | None |
| A0A822DS12 | 5-142 | None |
| H0EVN7 | 16-220 | None |
| H0ETK7 | 4-186 | None |
| H0ERV2 | 85-372 | None |
| H0EMW5 | 36-178 | None |
| H0EKW9 | 219-442 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.