DPCstruct | MC24576
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 144 ± 15 aa |
| Standard deviation of domain lengths | 14.81 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02724 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8ZJD3 | 313-458 | ARILFDYSQFTYFGPPTSMLMFELSWRLSKDTNELLWLSCVGLTDHFLTNKIEKENYTLLMGSLQNHVSRLNVGSQTQTLASYNMLR… |
| A0A5N5NQ69 | 1-136 | MGTFHGKSSGCLMYDLSHSLRKNMYELFWLACVLLADQFAYESLTDERYQARVMELEQHINSSGNLEAVTASSRIAYEDEPRLMLLR… |
| A0A2N0S9J1 | 148-288 | None |
| A0A7J9DCU8 | 197-317 | None |
| A0A7S2W204 | 2-155 | None |
| A0A3Q2PUY2 | 2-128 | None |
| A0A7J7IR56 | 241-389 | None |
| A0A388L452 | 126-280 | None |
| A0A445CAW2 | 119-231 | None |
| A0A2A4K7M8 | 181-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.