DPCstruct | MC24575
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 402 ± 41 aa |
| Standard deviation of domain lengths | 40.53 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.79 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0014- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G8PHP0 | 1-416 | MKRYRVGYIAMPGFNESELGEMQAVLGCHPLNRSSIIAPSKTPVTGQHGMTLVPNADFQDRTPLDVLVIPDIPEAAQDDPALHAFLT… |
| A0A4Q1ZT03 | 2-390 | DVILYISEAFNLMDMTVPYDLFRKMDEISVKVVGLTKGMVKSEDGISVQVPYGIEDIHHADLLWVCGGDLHSDLFEDQALHKWLKEM… |
| A0A1R3JWI4 | 3-351 | None |
| A0A1B0BL29 | 2-357 | None |
| A0A834L929 | 582-1052 | None |
| A0A7V4WKQ8 | 35-427 | None |
| A0A7J7C9A3 | 5-443 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.