DPCstruct | MC24569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 90 ± 16 aa |
| Standard deviation of domain lengths | 15.86 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 35.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B8LLE3 | 9-85 | AASASALPPAVTRFIERRQGCDHWRGEYSEDPVRRRQIEAGAKKECTGSDRELDRLRKLYRRNPAVRDALKDFEKVE |
| Q5GYR1 | 1-67 | MPEDVRKLVDDYDTCEHFAGEEPYDADRRHEIEVAVAQFCTPAPARLAKLMQQYRNEAHVSQWLRQY |
| A0A522XKT8 | 1-136 | None |
| A0A2W6WFY5 | 72-160 | None |
| A0A2W6SE40 | 22-126 | None |
| A0A2E2ZRD0 | 57-142 | None |
| A0A7Y1Q1V5 | 1-96 | None |
| A0A1N7CFR8 | 9-100 | None |
| A0A0K0SV84 | 8-93 | None |
| A0A3E1RJ62 | 14-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.