DPCstruct | MC24568
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 135 ± 17 aa |
| Standard deviation of domain lengths | 16.52 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S8VSE3 | 13-154 | TALSHDDRNKVASVHVYRSWLVHPRNITVDLIAIDGAATIDLTRALFQTAEALKDRKFGQVVLARQGKPVFIMEGPAFVELGQQYAA… |
| A0A5B8LGZ4 | 3-137 | ALSGEKHLTVAYRRWLISPNDIVFDVWRLAPDGSMADMDRQLFKAAEALKGRPFDHVVLAYHGVGRFMIDGAHFGVIGDSWSYQNPI… |
| A0A7X3P712 | 2-113 | None |
| A0A1N6EID2 | 35-180 | None |
| A0A142WTA0 | 187-313 | None |
| A0A2N3DH46 | 43-189 | None |
| A0A257YNC2 | 2-98 | None |
| A0A5C4R4F0 | 10-144 | None |
| A0A081C9G9 | 222-383 | None |
| A0A4P5W9R3 | 26-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.