DPCstruct | MC24567
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 143 ± 22 aa |
| Standard deviation of domain lengths | 21.79 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A225VWV2 | 4-142 | EVVPASFPQSAVHQPSDHTFFVGIPAWSQHLADDRYTRDGYGRLKVVQCVDGLTAVDLQDLAALIDQGSDVEALTLRPRSDRPLDIA… |
| A0A6A3WEW9 | 2-123 | SFIVGVPANSSDRLTERFMRDGYGGLEALSFAETLSDEDIQDLSEMVNPRLSIRPNFLLPKSIDATATAPEFRGLLNSMGAKRELAS… |
| A0A225WC76 | 51-168 | None |
| A0A6A4DRB9 | 173-300 | None |
| A0A080YXN5 | 11-192 | None |
| A0A6G0S121 | 39-179 | None |
| A0A6G0RL11 | 81-213 | None |
| A0A6G0RFZ4 | 216-355 | None |
| H3HAK1 | 148-291 | None |
| A0A329RT40 | 3-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.