DPCstruct | MC24560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 191 ± 27 aa |
| Standard deviation of domain lengths | 26.75 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 25.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4DN98 | 47-226 | DPASFKVLWDLAPWDDMFNQRLKFLILHQLDHMDAQAKSSLVDIVDFMWKHRRAFWLTGHWFFIDHRLDDYSAELHADRKKECDTAK… |
| A0A225VDR6 | 516-714 | QTKTPVRVPDDSDWDAAFLDEGNVSVVYASTPWGVLAKPVTPISFERDSPHFQTLSRKLDELQTKHRQAAWESTHSFPISEDLRRAV… |
| G4ZN22 | 507-721 | None |
| G4ZL35 | 288-520 | None |
| A0A225WT90 | 1-211 | None |
| A0A662Y303 | 11-212 | None |
| A0A662XD43 | 856-1047 | None |
| A0A6A3J241 | 1-146 | None |
| A0A225VYS1 | 169-389 | None |
| A0A225WMP0 | 1-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.