DPCstruct | MC2456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 99 ± 10 aa |
| Standard deviation of domain lengths | 9.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7NLI3 | 3-85 | SRWPKRRLEYAAEVIVEALKELQGGMSRQEVKDAARLHIGDTGLLDFVIKSINNYIIGNYMVLRTLIPSTRVLEININDVNSP |
| A0A445KAG8 | 68-167 | KQSSSKSKRKKHDSRDRWSAERYQLAEQNMWEVLKAEGATFENPITRPALRLAARKHIGDTGLLDHLLKHIDGKVAPGGTERFRRWF… |
| A0A2G5DU39 | 166-263 | None |
| A0A4P1R8C1 | 875-969 | None |
| A0A6D2I5Q8 | 117-214 | None |
| A0A6D2I636 | 190-282 | None |
| I1HUC5 | 372-462 | None |
| A0A2P2MM24 | 335-440 | None |
| A0A2P6RSB1 | 246-344 | None |
| A0A5N5IVA5 | 2-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.