DPCstruct | MC24558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 167 ± 17 aa |
| Standard deviation of domain lengths | 16.82 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 36.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A225VI05 | 13-187 | WTTTTPYRAVAWTFVCEVWRVLCLNCSMAAEIVAKYQEVVQDQTIQQIRGWAYVGALGGAALSVPTLVLSANEERYGRYGRMHCARW… |
| A0A225VBH6 | 2-181 | VWVLTTLFRLVAWTFTQQVWWVVRMNVGMCFEFIARYQDVLRSPELQQLSGPSYAYALWSVLFTVPVELLAEFDDDYGRYGRMVRSW… |
| W2YKK8 | 18-183 | None |
| A0A6G0R3E2 | 35-193 | None |
| A0A080ZKK8 | 1-149 | None |
| A0A6A3JD96 | 2-155 | None |
| A0A329RU31 | 10-189 | None |
| A0A225UZU9 | 5-184 | None |
| A0A6A4B3R9 | 34-193 | None |
| A0A6A3N000 | 61-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.