DPCstruct | MC2455
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 117 ± 11 aa |
| Standard deviation of domain lengths | 10.65 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7MAE1 | 1-113 | MWLVAANVVRWRRYGDGGQELRPGTKSYRGGAKVYVVDTYPGMAHEQVTTIGRARAGRWITVDTGSRHLHTFRAKLAYAPAVLRRVE… |
| A0A558C3P9 | 2-123 | LSQLKTYWTAVANVVANRPYGPNGAETRPASKHFAPGAKVYIIDYFPGTCSRVVVIGLHRKTKRMIKLILAVDFLENFKSKVCYTPA… |
| A0A7Y4ZRU8 | 4-125 | None |
| A0A7C3J7W1 | 148-244 | None |
| A0A5C7P628 | 7-111 | None |
| A0A7W7FWH2 | 9-134 | None |
| A0A1Q3WJB7 | 88-207 | None |
| A0A502TI90 | 3-110 | None |
| A0A1Z2LE68 | 66-182 | None |
| A0A066YSR2 | 7-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.