DPCstruct | MC24544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 142 ± 12 aa |
| Standard deviation of domain lengths | 12.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847YN17 | 1-140 | MKGEDVLAKMRGYGVAATLRTLQRYEAAGLLPPARRGWGDSGFGRFAEYSPAAVAEFYASYSLVHQYLWKVRFEDVPVVRETSLRLE… |
| A0A1U7MFQ9 | 3-139 | FNESTNVKNPTTIVQELDNKKIKITTRTLLNYENDKLIPQPERRGGGRGVGKITEYPSDTVYEFIASYRLINGAQHRLSPAVVREYR… |
| F7NN04 | 28-180 | None |
| F7NEH9 | 1-159 | None |
| A0A7C6PST9 | 1-122 | None |
| A0A7C6P7V8 | 23-155 | None |
| I8RLK7 | 4-144 | None |
| A0A4R2RPV0 | 1-116 | None |
| A0A357CN74 | 1-151 | None |
| A0A259UZU3 | 1-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.