DPCstruct | MC24540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 115 ± 15 aa |
| Standard deviation of domain lengths | 14.55 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 30.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12270 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q6AE85 | 6-103 | EWVGTVALALSAILAAFLAFYIGRSHASQGGELPEDRLDANIDDGDPELGHFSPWSWWPVALASAAALVLLGLAVGFWLCFIGVAFA… |
| A0A0M8UI63 | 2-114 | FFGATTAVYWWFSREPAGTAALCVSFVMASLVAAYLWRQYRRGGARPEDRGGAEIREAGGRRGFFPARSHFPALTAAGTALIGLGVV… |
| A0A538DDB9 | 20-141 | None |
| A0A0X3VQW2 | 14-126 | None |
| A0A3L6ZPK3 | 14-137 | None |
| A0A399XTY9 | 66-187 | None |
| A0A3D3YVN0 | 1-127 | None |
| A0A3C1CM33 | 37-168 | None |
| A0A7W0QH74 | 246-371 | None |
| A0A6J4HLZ0 | 13-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.