DPCstruct | MC24539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 97 ± 11 aa |
| Standard deviation of domain lengths | 10.88 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 23.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D4MYY7 | 3-86 | HRTLIGRAGVRCADGRRARLDYYLLRSGGRFGLEVRMRRGQERCRACLPELSHTPREVLRLGRTLHRGTVTPCAVRDVLEELLS |
| A0A416EGN9 | 1-105 | MKCAGKRRGWGRKMNKNHLIGTKELTYDNAHKMKLEYFLISEDRERTRSLYGIRIRKTVDARQVETETTPALSASRDFVEQMIYKLM… |
| R7FIM0 | 22-132 | None |
| B0MIX3 | 1-98 | None |
| A0A7X7VZ74 | 1-102 | None |
| A0A3D4VVG5 | 2-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.