DPCstruct | MC24537
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 170 ± 27 aa |
| Standard deviation of domain lengths | 27.24 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B8QKN0 | 5-150 | EFKNFAQRSLKPFDAWVKQAQLKEIKQGDSPKELIFDISEQLLNGYANSDLLSKYDIYQILMNYWADTMQDDVYVLMQDDWKAGNTI… |
| A0A0V8CEN4 | 281-422 | RKVAESFVAKYWHILRQVNPDSDLISLMSEMLSEIKTEVSSIEFVDAYSAYQIVAEIWKDSLTKDSELIAASDFYTIGRTREPNMVT… |
| A0A2T1C8W9 | 101-314 | None |
| A0A2S6H9Z8 | 1-179 | None |
| M5YDN8 | 1-216 | None |
| C0BVM5 | 140-282 | None |
| J0K407 | 95-269 | None |
| A0A1I1U2Z7 | 7-179 | None |
| A0A2T5JI22 | 177-349 | None |
| A0A374BNR6 | 16-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.