DPCstruct | MC24534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 165 |
|---|---|
| Mean domain length (aa) | 185 ± 38 aa |
| Standard deviation of domain lengths | 38.32 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 17.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0322 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B8QEL5 | 14-192 | YMDGASTDYSEKTPELVVSIDKERAADLGITQSEISDTLEIMLGGKSETTYVDRGQEYDVYLRGDENSFNNIADLSQIYLRTINGDL… |
| A0A498F6S3 | 7-163 | DELYKATQALQAKAWGTPQLAGVFSSYQINVPQLFADVDRVKAKQLGVPLSTIYQTLQVNLGSLYVNDFNQFGRTYQVRVQADAQFR… |
| A0A3N9NF38 | 518-715 | None |
| A0A2V7WK54 | 514-740 | None |
| A0A5C8EGG8 | 291-445 | None |
| A0A1E4HTX1 | 29-216 | None |
| A0A212DW87 | 51-242 | None |
| A0A377CFN0 | 2-133 | None |
| A0A377D476 | 5-174 | None |
| A0A2S8PEE1 | 892-1122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.