DPCstruct | MC24529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Standard deviation of domain lengths | 9.01 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 80.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16639 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K9RWA6 | 1-80 | MQLKQVLANGKNGGLNVGDVLILPEGFELAPPDRISPEIKENIGNLSFQSYRPNKQNILVIGPVPRQTYSEITFPILAPR |
| A0A3P6G4M5 | 90-169 | MQLKQVLANGKKGALNVGAVLILPEGFELAPPDRISPEMQEKIGNLSFQNYRPNKKNILVIGPVPGQKYSEITFPILAPD |
| A0A1U8FRH4 | 313-392 | None |
| A0A6P6FNM4 | 274-352 | None |
| M7ZBD0 | 90-153 | None |
| M8A9Z1 | 53-114 | None |
| A0A4S8I3T6 | 13-86 | None |
| A0A4S8I5Y7 | 631-709 | None |
| A0A4S8I6G3 | 79-156 | None |
| A0A2R6XFF3 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.