DPCstruct | MC24526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 143 ± 11 aa |
| Standard deviation of domain lengths | 10.75 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6EPL4 | 10-140 | NCSISIFSNSRCGFSNYFPSEHNLITISSCNININSHLQSLQLSKTCIPSEGHLIFFRLGIFTLFCDYTICPHHRATLGIRWRRSVA… |
| A0A8B6E941 | 5-149 | RCNFSIFCNTECGFSPYFQEDQTDISIANCSKNIENHLASVGLKSDDIPTEGHLICFRVGIFSALKSYAVCPLHRYALGICWRKKAG… |
| A0A7R8XK80 | 74-213 | None |
| A0A6S7GN71 | 1-150 | None |
| A0A6S7G1H3 | 1-157 | None |
| A0A6S7FW97 | 197-345 | None |
| A0A8B6D4B6 | 6-148 | None |
| A0A6S7HE61 | 2-125 | None |
| A0A7D9DJY3 | 8-159 | None |
| A0A7D9DK70 | 4-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.