DPCstruct | MC24525
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 135 ± 24 aa |
| Standard deviation of domain lengths | 23.61 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 42.52 |
| Pfam Score | 85.12 |
| Assigned Pfam label(s) | PF00631- CL0272- PF18148 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4VHT2 | 1-119 | MRARSKVSQAAECLVASYETYLEFDPLLSPVLPSNPWLTDDPTFMELGQPLVECPTEWRVRRWAISLDELAADPTGLHEITKCMQKE… |
| A0A671UI27 | 142-267 | IFYQQAIMRSKVKSSVSLGALVKYVTTYKNHDPFLAPCLPSNPWQTDNDTYWNLNMRRVEVPTKSRVERWSFSFFELLSDLRGRDDF… |
| A0A3P7JD52 | 52-197 | None |
| A0A7I1A6S0 | 349-465 | None |
| A0A6P4JZY1 | 384-544 | None |
| A0A7R9E980 | 19-164 | None |
| A0A5E4Q4M0 | 35-192 | None |
| A0A4Z2G1A7 | 90-191 | None |
| A0A7J7AXA2 | 47-206 | None |
| A0A3Q3IVF8 | 211-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.