DPCstruct | MC24524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 544 |
|---|---|
| Mean domain length (aa) | 170 ± 30 aa |
| Standard deviation of domain lengths | 30.47 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 12.14 |
| Pfam Score | 95.89 |
| Assigned Pfam label(s) | CL0116- CL0080- CL0456- CL0172- PF10504 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E1NC39 | 5-148 | EFVDLERFMGDWYVIANIPTFIEKRATNAIESYELMEDGKTIKTTFSFFNDSPDGKKKVYNPTGFVYNSETNAEWRMQFIWPFKSVF… |
| A0A8B6E124 | 16-181 | SLATCQVPRWGSCPDIPVKQNFDADRYLGKWYENEKFFFIAEIGLKCISANYSLNNDGSIKVLNAGINTRTGRPSEAVGRATIGEKE… |
| E9FY93 | 2-146 | None |
| A0A7E4VJU0 | 4-171 | None |
| A0A417DF35 | 44-293 | None |
| A0A1D2N414 | 32-180 | None |
| A0A182FKT6 | 118-323 | None |
| A0A1X6PG02 | 209-400 | None |
| A0A834Y2I5 | 3-151 | None |
| A0A834Y487 | 22-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.