DPCstruct | MC2452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Standard deviation of domain lengths | 6.01 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 51.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14370 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L1KZU7 | 110-184 | RISKTKYKLTQVKALKQIKSDGKTVSTGTSKANYIDPRIVFAWSKRYSVPIKKLFSQTLIKKYYWAAEVDENFKF |
| W6LAK5 | 141-213 | IERYKERLNRELNAIAIKDDNKTVSLGTSKVNYIDPRIICSWAKEQNVPINKIFSATLQKKFSWALDAQGFNF |
| A0A1Y1L1G2 | 115-193 | None |
| A0A7T8QWL2 | 74-150 | None |
| A0A5B7F6W6 | 112-199 | None |
| A0A7R9WUW3 | 262-337 | None |
| A0A109FGF5 | 64-143 | None |
| A0A6P5R7B6 | 118-187 | None |
| D8RGC1 | 66-152 | None |
| S9V2L0 | 42-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.