DPCstruct | MC24518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 221 ± 29 aa |
| Standard deviation of domain lengths | 28.56 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M6XBA8 | 1-212 | MTFGPSNSSSNGTAQNITSNNCNGSYVARLKPREFVRFLETHDITCVDKFVWNYDQYSNYIYSQENMLEVVDRLKVLAPHYRGNNDL… |
| A0A495X3T1 | 29-205 | ACAVADFASATGAQLVKVVRGADTSCVNTLFGLTGSDARNVFREAQMVSVADALRADAATYAGDNRTSTAQLVLFLRAGYYVQWYHP… |
| Q7NWI8 | 4-274 | None |
| A0A3A8RRQ2 | 8-210 | None |
| A0A0F4J8P9 | 96-300 | None |
| A0A6B2W2U5 | 120-343 | None |
| A0A355D8B1 | 73-319 | None |
| A0A7R8P023 | 2-262 | None |
| V6I489 | 3-240 | None |
| A0A655PK49 | 2-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.