DPCstruct | MC24513
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 129 ± 11 aa |
| Standard deviation of domain lengths | 10.79 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 44.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4JJA5 | 221-354 | INQLVLHEEDKLKVFDKNSPYLATKKIGKNNPMEEQIKADNEVRQEWNRTVDRAIVSGVSEEDISRIKKNEITEKVRYSIDLYGDRP… |
| A0A3A8WEV6 | 101-215 | FTAFINTFVFDEKKKLAVFDKHSPYLTTKKIGKNNPREEQIKTDNWARTEWNRTVDRTLVEGISREEVLQVKREEITEKVQESVHKW… |
| K1UQ76 | 58-169 | None |
| A0A4S2HJZ3 | 19-130 | None |
| A0A1C6IY49 | 2-137 | None |
| A0A0J1G0L6 | 1-129 | None |
| A0A373IQI9 | 134-272 | None |
| A0A7X7RR87 | 104-238 | None |
| A0A0J8YYD4 | 65-205 | None |
| A0A7X5D528 | 70-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.