DPCstruct | MC2451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 129 ± 20 aa |
| Standard deviation of domain lengths | 19.57 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.26 |
| Pfam Score | 98.44 |
| Assigned Pfam label(s) | CL0123- CL0014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L1KZQ0 | 6-119 | KNRDEILMELFTDGVMVCKKEFGKHLKLNVSNLEVINLMRSFKAKKYVDEVYVWHHFYWTLTEAGIEYIRKLLYIKPNIVPNTMKAG… |
| T0MJP2 | 1-85 | MSLTIAQKIKVYKHFSEKGALLIFDKQHESNKILNINNKKLRSFIQSLKDRGYVKEYYVWQQAYILATNSGMEFFDEETRIPDKL |
| A0A3P6EKM5 | 53-159 | None |
| A0A4U0V661 | 11-154 | None |
| A0A7R9KG05 | 132-273 | None |
| A0A5J5CV24 | 5-160 | None |
| A0A0H5BKK1 | 1-83 | None |
| A0A4Q2DMH7 | 292-433 | None |
| A0A1S3EF67 | 344-492 | None |
| A0A2C9VT66 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.